Skip to content

Amazing Foods TV

  • Home
  • Recipes
  • How To
  • FoodExpand
    • Beef
    • Chicken
    • BBQ and Grilling
    • Sea Food
    • Pasta
    • Pork
    • Turkey
    • Vegan
    • Desserts
    • Smoothies
  • Contact
  • AmazingFoodsTV Blog
Amazing Foods TV

  • Make The BEST Japanese Beef Curry Using Roux Cubes [ULTIMATE GUIDE]
    How To | Pork | Recipes

    Make The BEST Japanese Beef Curry Using Roux Cubes [ULTIMATE GUIDE]

    Byamazingfoodstv December 15, 2024

    In this video, I’m sharing my 15+ years of Japanese curry secrets! Learn how to transform basic roux cubes into restaurant-quality curry using simple ingredients and game-changing tips that most home cooks don’t know about. Hit subscribe and turn on notifications so you never miss out on more secret Japanese recipes like this one! 🖨…

    Read More Make The BEST Japanese Beef Curry Using Roux Cubes [ULTIMATE GUIDE]Continue

  • Chicken Pakodi Recipe || 1KG || Street Style Chicken Pakoda | Evening snacks ||
    Uncategorized

    Chicken Pakodi Recipe || 1KG || Street Style Chicken Pakoda | Evening snacks ||

    Byamazingfoodstv December 15, 2024

    #chickenpakodi #chickenpakodiintelugu #chickenpakodarecipe #streetstyle #chickenrecipe source

    Read More Chicken Pakodi Recipe || 1KG || Street Style Chicken Pakoda | Evening snacks ||Continue

  • Giant Gajar Ka Halwa Recipe – The 400kg Carrot Dessert!
    Desserts | How To | Recipes

    Giant Gajar Ka Halwa Recipe – The 400kg Carrot Dessert!

    Byamazingfoodstv December 15, 2024

    This Mega Kitchen Making 400kg Gajar Ka Halwa & Sold Out Every Day! Mind-Blowing Skills! Amazing Cooking & Prepared Gaja Ka Halwa Mega kitchen Tour How to Make Gajar Ka Halwa l Street Style Experience the ultimate sweet indulgence as we unveil the making of a colossal 400KG Gajar Ka Halwa! Witness the magic of…

    Read More Giant Gajar Ka Halwa Recipe – The 400kg Carrot Dessert!Continue

  • ബ്രെഡ് വെച്ചു പല തരം വിഭവങ്ങൾ |Bread snack recipe Malayalam |Evening Snack recipe in Malayalam#snack
    Breads and Rolls | How To | Recipes

    ബ്രെഡ് വെച്ചു പല തരം വിഭവങ്ങൾ |Bread snack recipe Malayalam |Evening Snack recipe in Malayalam#snack

    Byamazingfoodstv December 15, 2024

    #breadtoastrecipe #breadrecipe #breaddessertrecipe #malayalamrecipe #tabassumskitchenrecipe #breadtoastrecipe #breadpuddingrecipe #puddingrecipe 00:00 intro 00:14 Soft bread toast recipe 02:23 Masala Bread toast recipe 04:24 simple Bread toast recipe 06:00 variety bread toast 09:14 feench toast recipe 3:34 ice cream bread toast recipe eggsnackrecipe #breadsnackrecipe #easyrecipe #breadpola #eveningsnacksrecipeinmalayalam #easybreakfastrecipeinmalayalam #tabassumskitchenrecipe #malayalamrecipe #nalumanipalaharam #kidsspecialrecipes #lunchboxrecipe #tiffinboxrecipe #pizzarecipe egg snacks easy…

    Read More ബ്രെഡ് വെച്ചു പല തരം വിഭവങ്ങൾ |Bread snack recipe Malayalam |Evening Snack recipe in Malayalam#snackContinue

  • 🔥Protein shake 💯must try guys ‼️#shorts #protein#bananashake#breakfast #viralvideo
    How To | Recipes | Smoothies

    🔥Protein shake 💯must try guys ‼️#shorts #protein#bananashake#breakfast #viralvideo

    Byamazingfoodstv December 15, 2024

    Health Benefits✅ 1. Rich in Potassium: Helps lower blood pressure and supports healthy heart function. 2. High in Fiber: Promotes digestive health and satiety. 3. Antioxidant-Rich: Protects against cell damage and inflammation. 4. Good Source of Vitamins C and B6: Boosts immunity and energy. 5. Supports Healthy Bones: Rich in calcium, magnesium, and potassium. Nutritional…

    Read More 🔥Protein shake 💯must try guys ‼️#shorts #protein#bananashake#breakfast #viralvideoContinue

  • Crispy Surami Rava Fish Fry Madhura | सुरमई फिश फ्राय की भरला पापलेट
    How To | Recipes | Sea Food

    Crispy Surami Rava Fish Fry Madhura | सुरमई फिश फ्राय की भरला पापलेट

    Byamazingfoodstv December 15, 2024

    Surmai fish fry pomfret fish fry paplet fish fry bharla paplet kolambi tawa masala source

    Read More Crispy Surami Rava Fish Fry Madhura | सुरमई फिश फ्राय की भरला पापलेटContinue

  • Want Crispy Pork Belly? You Need To Do This…
    How To | Pork | Recipes

    Want Crispy Pork Belly? You Need To Do This…

    Byamazingfoodstv December 15, 2024

    There is nothing better than crispy, crunchy pork crackling. If you get it right, it’s an absolute delight. But how many times have you opened the oven and instead of super crispy crackling, you’ve been met with a flabby soggy tray of misery! I’ve got a method that will guarantee you teeth shattering crispy crackling…

    Read More Want Crispy Pork Belly? You Need To Do This…Continue

  • Fish fry l egg carry l egg recipes l biryani l #fish l #egg
    How To | Recipes | Sea Food

    Fish fry l egg carry l egg recipes l biryani l #fish l #egg

    Byamazingfoodstv December 15, 2024

    source

    Read More Fish fry l egg carry l egg recipes l biryani l #fish l #eggContinue

  • Healthy Banana Shake 🍌 #shorts
    How To | Recipes | Smoothies

    Healthy Banana Shake 🍌 #shorts

    Byamazingfoodstv December 15, 2024

    Easy Healthy Banana Shake 🍌 #shorts #trending #food #recipe #asmr #shortsfeed source

    Read More Healthy Banana Shake 🍌 #shortsContinue

  • Multi colour cake design | cake recipe #viralvideo #cake #youtubeshorts #shorts #trend #trending
    Desserts | How To | Recipes

    Multi colour cake design | cake recipe #viralvideo #cake #youtubeshorts #shorts #trend #trending

    Byamazingfoodstv December 15, 2024

    source

    Read More Multi colour cake design | cake recipe #viralvideo #cake #youtubeshorts #shorts #trend #trendingContinue

Page navigation

Previous PagePrevious 1 … 3,682 3,683 3,684 3,685 3,686 … 10,050 Next PageNext

© 2026 Amazing Foods TV - WordPress Theme by Kadence WP

  • Home
  • Recipes
  • How To
  • Food
    • Beef
    • Chicken
    • BBQ and Grilling
    • Sea Food
    • Pasta
    • Pork
    • Turkey
    • Vegan
    • Desserts
    • Smoothies
  • Contact
  • AmazingFoodsTV Blog