Similar Posts
How to Make Perfectly Fluffy Falafel and Moroccan Lentil and Chickpea Soup
In this episode, test cook Elle Simone and host Julia reveal the secrets to making foolproof Falafel at home. Tasting expert Jack Bishop challenges Bridget to a tasting of canned chickpeas, and test cook Becky Hays makes Bridget the ultimate Harira (Moroccan Lentil and Chickpea Soup). Get the recipe for Falafel: Get the recipe for…
Eggplant Steak #shorts
Veal steak! 2 medium eggplants Bake for 40 minutes at 200 degrees. Tempura: 2 eggs Flour Ground breadcrumbs Sauce: 1 onion … source
#delicious😋😍#pasta#food recipes#newsnacksrecipevegdeliciouskhanarecipenewvarietydishesdeliciouskhane
Hello friends Thanks for watching ❤️ Please Like share comment new recipe with new launch recipe yammy khana chopsuey … source
Do you have Orange Make this delicious dessert in a minute with few ingredients!
Do you have Orange? Make this delicious dessert in a minute with few ingredients! With Orange Juice you can make this delicious dessert, quick and easy dessert that everyone can make. Better than store bought sweets everyone will enjoy! Just 3 ingredients and few minutes work, the result will amaze you! Recipe ingredients 240 ml…
48 Comments
Leave a Reply
You must be logged in to post a comment.
Detailed recipe is on
breakthespicerecipes.com
Wheres the salt?
A comida é sempre vermelha. Interessante.
Hey gonna make dis for mah love4lyf today 🤙
Hope my parents wont be mad at me for making this lol
What did she sprinkled in the oil?
I got recovered here after watching bayashi's video 💀
My brother tried this recipe and he fried onion so much that the spaghetties turned into the color of your toppinhn😂😂!!!
On a spice lvl from 1-10 how spicy is it
that looks simple and very yummy.
So I didn’t have chili flakes so I used chili powder and I didn’t have garlic cloves so I just skipped it😂
The way the noodles twisted together at the end was cinematic
Hot spaghetti. Pizza tower.
TOMATOES🍅??
These are chowmin for indians😅
Hi
Me: Spawns Lionfield
good spaghetti cooking
❤❤❤❤❤
Looks amazing absolutely delicious❤
Y'all break don't break spaghetti?
Y'all don't break spaghetti?
Taste 👍👌
This is art ❤.
Kukm ka lumpa asmar lampi lop
It mean . I love it 😀
Tanka
Simpler and taster hahahahh
I made it it's so good❤❤
Can i use garlic paste and onion paste Instead of choped onions?
So creamy 🤤
Food😮
i don't see the protein, wrong way
https://youtube.com/shorts/uR8I1aw3Duc?si=0abr1yUzP_DU98P-
Thnks good gareeb bannda bana sakkta baki bht kuch ingredients main dalty this is for me
Mine did not turn red😭
Spicy ?
🤌🇮🇹🍝🍝💚🤍❤
tf did you make me make bro
I added some capsicum and tofu.. it turned out good in my opinion but none in my FAM complimented me
Ummm…aren't tomatoes supposed to be in there?just asking
How did you make this spaghetti can you teach me and add meatballs
She made chow mein with spaghetti
But how to cook the pasta?
Yummy 🤤
good and simple one✨
something sonething about making pasta without the use of deepfrying it then get da chance of getting a heart attack
chef kiss cooking btw
Did I miss anything? How did the pasta turned that red? 😅
Jast wow