பெப்பர் சிக்கன் semi gravy-சாதம்,சப்பாத்தி & தோசைக்கு👌| Pepper Chicken in Tamil | CHICKEN KULAMBU
பெப்பர் சிக்கன் semi gravy- சாதம், சப்பாத்தி & தோசைக்கு👌 | Pepper Chicken Recipe in Tamil | CHICKEN KULAMBU
source
Similar Posts
ఈ శివరాత్రి పండుగకు తప్పక చేయవలిసిన వంటకం Thambittu | Sweet Recipes In Telugu | Healthy Recipe
ఈ శివరాత్రి పండుగకు తప్పక చేయవలిసిన వంటకం Thambittu | Sweet Recipes In Telugu | Healthy Recipe | Thambittu Recipe | Sweet@karanyaskitchen #sweetsnacks #sweets #healthyrecipes This is my new video if you like my video please subscribe to my channel and support me. source
Avocado smoothie | healthy breakfast smoothie | avocado oats weightloss smoothie | hams food
description #easysimpledelicious #healthyavocadosmoothie #avocado Avocado smoothie, Healthy breakfast avocado smoothie recipe, avocado oats weightloss smoothie, Avocado weightloss smoothie, avocado oats smoothie, healthy avocado smoothie, Healthy avocado breakfast smoothie, Avocado healthy breakfast smoothie weightloss, avocado healthy breakfast smoothie almond milk, healthy avocado smoothie for weightloss, healthy avocado breakfast smoothie no banana breakfast smoothie,healthy smoothie recipes,healthy smoothies,green…
Learn How to Prep Your Chicken Like a Pro
Lan Lam demonstrates how to prep, truss, and spatchcock a whole chicken. Click the related video to learn more. Subscribe to America’s Test Kitchen: Watch full episodes of America’s Test Kitchen and Cook’s Country for free on our new YouTube channel: Watch More! In The Test Kitchen: The Taste Test: Techniquely…
Weight Loss Vegan Smoothie Recipes #shorts
1) Weight Loss Vegan Smoothie Recipes 👉 2) Smoothies Made From Vegan Ingredients Additionally, protein is a crucial component for losing weight. Consuming enough protein each day can increase metabolism and decrease hunger, which makes it simpler to lose weight without losing muscle. Because of this, protein smoothies have been demonstrated to boost vegan athletes,…
#delicious😋😍#pasta#food recipes#newsnacksrecipevegdeliciouskhanarecipenewvarietydishesdeliciouskhane
Hello friends Thanks for watching ❤️ Please Like share comment new recipe with new launch recipe yammy khana chopsuey … source
37 Comments
Leave a Reply
You must be logged in to post a comment.
Super cook mmm lovely yammy nice 😋🤗👌👍🙏👌❤❤❤
உங்கள் சமையல் சூப்பர் அக்கா
Salt??
Mam kudal kulambhu, roast indha recipe ninga potta nalla iruku… I'm eagerly waiting mam. Ungaloda yella recipes um vera level tast mam🎉
Hi sis ennaikku chicken yeduthu entha recipe tha senjirukke mam semma supper aa vandhu erukku taste supper
Super abhi iam from bangalore
அருமையாக 👌
Sis double beans recipes podunga..
Supar mam
Akka give my some tips for muruku plzzzzzzzzzzzz 💜
முட்டை பப்ஸ் செய்வது எப்படி வீடியோ போடுங்க
Today unga recipe pathu ragi chimizhi senja sis perfect and tasty 😋 1st time try panna nalla vanthu iruku tq❤❤
Abi,next time Butter chicken cook pannunga
Already i tried mutton champaran
Its very delicious and tasty 😋🤤
Thank you so much❤
Looks very easy. . will try ❤
Super sis
Karuppu yeakai illana ena pandrathu sis atha skip Panna recipe nalla varuma🙂
Super chicken 🐔 curry 🍛
❤❤❤ super abi chellam
Nice akka ❤
Upper island pandam kuppaile
You have not added salt
Akka nalla samaikiriga but pecha kammi pannunga ple your recipe are nice
What about salt and coriander powder
Super sis unga video pardhutha no en samayal impure panni iruken ❤
Super mam
Pepper chicken Super sis
Hi
Super gravy ❤
தனியா தூள் அவசியமில்லையா??
Vala karuvadu thokku recipe for beginners video podunga sis your cooking recipes are very useful for me thank you so much ❤
FINE…THANKS
Hiii abi sis semma♥️😋👌🏻👌🏻
அபிபெப்பர்சிக்கன்சூப்பர்
Super
Arumai 😋🙏❤️🤝👍👌
வழ வழ னு பேசாம தேவையானத மட்டும் correct ஆ பேசி ஜெயிச்சுடீங்க…..வாழ்த்துக்கள்🎉
Super 👌