Similar Posts
Ramzan Special Dessert | Milk Malai Cake Recipe | No Cook Dessert Recipe | Quick and Easy Dessert
Ramzan Special Dessert | Milk Malai Cake Recipe | No Cook Dessert Recipe | Quick and Easy Dessert . . . . . . . . . #dessert … source
GNC Smoothie Recipes – How To Make A Smoothie Recipe Basics 101
Make your own smoothie drink! Choose from an assortment of high protein powders, healthy foods, fruit and veggies to create new and unique smoothie recipes. tep 1: Choose a base It could be: juice, ice coffee, coconut water or milk, water, almond milk, or tea. Step 2: Pick your fruit (about ½ cup) Banana, pineapple,…
Quick & Easy Chocolate Banana Smoothie Bowl | Tropeaka Recipes
CHOCOLATE BANANA SMOOTHIE BOWL Start your day with this nourishing smoothie bowl recipe! INGREDIENTS: ▸ 2 … source
How To Make Perfect Chocolate Chip Banana Bread Every Time | Delish Insanely Easy
There are thousands of banana bread recipes out there—this is the only one you’ll ever need. Full recipe: SUBSCRIBE to delish: FOLLOW for more #DELISH! Facebook: Twitter: Instagram: Pinterest: Google+: source
# short video #Dil wala Paratha recipe
#shorts video #YouTube shorts video #Dhruvi kitchen #Dil wala paratha kaise bnaye #Dil wala paratha ghar pe kaise banaye source
Mango pomelo sago yogurt shake
Say goodbye to non-dairy creamer and elevate your #tea #bubbletea #latte and more with our Coconut oil powder alternatives. source
16 Comments
Leave a Reply
You must be logged in to post a comment.
This is stew from a can style. It needs some tomato paste, a dash of vinegar and 2 tbsp of brown sugar, Worcestershire etc. In order to get the beef tender you need to simmer for about 2 hrs. This flour mixture is going to make it hard not to burn before the beef is tender.
Throw some corn and green beans in there my mom used to make it that way!!!
😂swozecp🎉email address jsd
Jaszsckllaxrflmlxdxlmnnkmlqdklmlsdedlklwddflpmkmkdzqzdqsrxlpkllminkln❤kodojpwxa swxkpkpk0kn❤swdpkpkkmkkkm😂setfwpxe
I found your recipe a few years ago. It's the only one I use, every time I feel like having some good comfort food. I appreciate you sharing your recipe. Thank you!
Awesome Video..Thanks🤝..
This is it…home comfort stew
How long did you let everything cook?
Recipe or it didn’t happen
Thank you
2 TBSP Corn starch and COLD water to thicken the stew so it isnt soup
1 or 2 lbs beef???
I'm sorry but I couldn't eat that with that black potato floating around. What is that blacker than black potato all about atall?
Thanks for sharing your quick recipe.
Looks good but couldn’t follow the recipe at all.
Looks delicious