Similar Posts
The Best Banana Bread Recipe Ever |Chocolate Walnut Banana Bread| Simple Recipe for Baking Beginners
Learn how to make the best banana bread that’s moist, tender, melt-in-your-mouth, packed with walnuts and chocolate chips, and perfect if you enjoy cozy baking days! This easy banana bread recipe uses brown butter, brown sugar, and ground almonds to add a unique twist, making it a must-try whether your are a beginner baker or…
High Protein Oats & Chia Seeds Smoothie for Weight Loss | Weight Loss Smoothie Bowl |Smoothie Recipe
High Protein Oats & Chia Seeds Smoothie for Weight Loss | Weight Loss Smoothie Bowl |Smoothie Recipe Back in Shape in 7 Days Powerful Oats Smoothie for Weight Loss |Oats Smoothie Recipe for Weight Loss Healthy Weight Loss Smoothie Power Bowl.Easy Smoothie Recipe for Weight Loss|Back in Shape in 7 DAYS #smoothie #weightloss #oatssmoothie #highprotein…
تری والا چکن سالن | Chicken Curry Recipe | Very Quick &Tasty Chicken Recipe
Learn how to make authentic Punjabi chicken curry with rich spices and thick gravy. Perfect traditional style recipe for lunch or … source
Mango Almond coconut smoothie #shorts #youtubeshorts #ytshorts #shortvideo #ashortaday
share, like and subscribe @HomemadeHeavenlyFood source
Nutty Chocolate Bread Rolls #shorts
Nutty Chocolate Bread Rolls #shorts #chocolatebreadroll #breadrolls #asmrsounds Watch how to make delicious Nutty Chocolate … source
Maggi #shorts #selinesrecipes #eveningsnacks #maggi
Maggi Diwali🪔SPL recipe #shorts #selinesrecipes #eveningsnacks #maggi #maggimixture#bread#eveningsnacks#breadtoastrecipe#selinesrecipes [Instant Snacks Recipes,Evening Snacks Recipe,Kids Snacks,Lock-down Munchies,Lockdown Recipes,quick tea time snacks recipes,Snacks recipes,easy snacks,instant snacks,quick snacks,instant veg snacks recipes,homemade snacks,indian snacks for kids,healthy evening snacks indian,instant evening snacks indian,easy snacks to make in 5 minutes,5-minute recipes,5 minute recipies indian] subscribe fore more recipes Checkout these must watch…
16 Comments
Leave a Reply
You must be logged in to post a comment.
This is stew from a can style. It needs some tomato paste, a dash of vinegar and 2 tbsp of brown sugar, Worcestershire etc. In order to get the beef tender you need to simmer for about 2 hrs. This flour mixture is going to make it hard not to burn before the beef is tender.
Throw some corn and green beans in there my mom used to make it that way!!!
😂swozecp🎉email address jsd
Jaszsckllaxrflmlxdxlmnnkmlqdklmlsdedlklwddflpmkmkdzqzdqsrxlpkllminkln❤kodojpwxa swxkpkpk0kn❤swdpkpkkmkkkm😂setfwpxe
I found your recipe a few years ago. It's the only one I use, every time I feel like having some good comfort food. I appreciate you sharing your recipe. Thank you!
Awesome Video..Thanks🤝..
This is it…home comfort stew
How long did you let everything cook?
Recipe or it didn’t happen
Thank you
2 TBSP Corn starch and COLD water to thicken the stew so it isnt soup
1 or 2 lbs beef???
I'm sorry but I couldn't eat that with that black potato floating around. What is that blacker than black potato all about atall?
Thanks for sharing your quick recipe.
Looks good but couldn’t follow the recipe at all.
Looks delicious